logo Eng Translation language: Arabic English French German Persian Russian Somali Spanish Log In
logo Log In

Choose translation language

english Right arrow

Language

Contact

envelope contact@kieli.net
  • Social Instagram
  • Social Facebook
Float menu

Language

Close menu

juurikasvi, noun

Word analysis
juurikasvi

juurikasvi

juurikasvi

Noun, Singular Nominative

juuri

Noun, Singular Nominative

+ kasvi

Noun, Singular Nominative

Report an issue

Declensions

Singular

Plural

Nom

-

juurikasvi

juurikasvit

Par

-ta

juurikasvia

juurikasveja

Gen

-n

juurikasvin

juurikasvien

Ill

mihin

juurikasviin

juurikasveihin

Ine

-ssa

juurikasvissa

juurikasveissa

Ela

-sta

juurikasvista

juurikasveista

All

-lle

juurikasville

juurikasveille

Ade

-lla

juurikasvilla

juurikasveilla

Abl

-lta

juurikasvilta

juurikasveilta

Tra

-ksi

juurikasviksi

juurikasveiksi

Ess

-na

juurikasvina

juurikasveina

Abe

-tta

juurikasvitta

juurikasveitta

Com

-ne

-

juurikasveine

Ins

-in

-

juurikasvein

Declensions

Singular

Plural

Nom

-

juurikasvi

juurikasvit

Par

-ta

juurikasvia

juurikasveja

Gen

-n

juurikasvin

juurikasvien

Ill

mihin

juurikasviin

juurikasveihin

Ine

-ssa

juurikasvissa

juurikasveissa

Ela

-sta

juurikasvista

juurikasveista

All

-lle

juurikasville

juurikasveille

Ade

-lla

juurikasvilla

juurikasveilla

Abl

-lta

juurikasvilta

juurikasveilta

Tra

-ksi

juurikasviksi

juurikasveiksi

Ess

-na

juurikasvina

juurikasveina

Abe

-tta

juurikasvitta

juurikasveitta

Com

-ne

-

juurikasveine

Ins

-in

-

juurikasvein

Get Premium! For Unlimited access Log in or Get Premium. You can now close this dialog and continue using Kieli.net in 4s. First 7 days FREE Trial!

Start Free Trial

Close

root
root vegetable
Show more arrow right
EurLex-2; Eurlex2019; eurlex; EuroParl2021 rehuna käytettävät juurikasvit. Root vegetables for foraging. Juurikasvien listimisns-ja nostokoneet. Beet -topping machines and beet harvesters. Muut juurikasvit, muualle luokittelemattomat. Other root crops n.e.c. Viljakasvien oljet ja rehuna käytettävät juurikasvit. Tomato pulp. Yhdistetty viljojen, öljykasvien, valkuaiskasvien ja juurikasvien viljely. Cereals, oilseeds, protein crops and root crops combined. Muut juurikasvit, sipulit ja mukulat (ruohosipulit, retiisit ja retikat, nauriit, piparjuuret. Other root and tuber crops (chives, radishes, French turnips, horse radishes). Juurins-ja mukulakasvien nostokoneet (pois lukien perunannostokoneet, juurikasvien listimisns-ja nostokoneet). Root or tuber harvesting machines (excluding potato-diggers and potato harvesters, beet- topping machines and beet harvesters). Kaikki raakana kulutettavat ravintokasvit, joiden syötävä osa on suoraan kosketuksessa uusioveteen, sekä raakana kulutettavat juurikasvit. All food crops consumed raw where the edible part is in direct contact with reclaimed water and root crops consumed raw. Tätä tarkoitusta varten viljelykasvit voidaan jakaa viiteen ryhmään: juurikasvit, lehtikasvit, hedelmät, palkokasvit ja öljysiemenet, viljat. For this purpose crops can be considered as falling into one of five categories: root vegetables, leafy crops, fruits, pulses and oilseeds, cereals. Sinimailanen, sinimailasjauho, apila, apilajauho, ruoho (rehukasveista), viherjauho, heinä, säilörehu, viljakasvien oljet ja rehuna käytettävät juurikasvit. Lucerne, lucerne meal, clover, clover meal, grass (obtained from forage plants), grass meal, hay, silage, straw of cereals and root vegetables for foraging. Show more arrow right

Wiktionary

A plant that is cultivated for production of root vegetables, e.g. carrot, beet, potato, onion. Show more arrow right juures Show more arrow right juuri (“root”) +‎ kasvi (“plant”) Show more arrow right

-ni

-si

-nsa (singular)

Singular

Plural

Singular

Plural

Singular

Plural

Nom

-

juurikasvini

juurikasvini

juurikasvisi

juurikasvisi

juurikasvinsa

juurikasvinsa

Par

-ta

juurikasviani

juurikasvejani

juurikasviasi

juurikasvejasi

juurikasviansa / juurikasviaan

juurikasvejansa / juurikasvejaan

Gen

-n

juurikasvini

juurikasvieni

juurikasvisi

juurikasviesi

juurikasvinsa

juurikasviensa

Ill

mihin

juurikasviini

juurikasveihini

juurikasviisi

juurikasveihisi

juurikasviinsa

juurikasveihinsa

Ine

-ssa

juurikasvissani

juurikasveissani

juurikasvissasi

juurikasveissasi

juurikasvissansa / juurikasvissaan

juurikasveissansa / juurikasveissaan

Ela

-sta

juurikasvistani

juurikasveistani

juurikasvistasi

juurikasveistasi

juurikasvistansa / juurikasvistaan

juurikasveistansa / juurikasveistaan

All

-lle

juurikasvilleni

juurikasveilleni

juurikasvillesi

juurikasveillesi

juurikasvillensa / juurikasvilleen

juurikasveillensa / juurikasveillean

Ade

-lla

juurikasvillani

juurikasveillani

juurikasvillasi

juurikasveillasi

juurikasvillansa / juurikasvillaan

juurikasveillansa / juurikasveillaan

Abl

-lta

juurikasviltani

juurikasveiltani

juurikasviltasi

juurikasveiltasi

juurikasviltansa / juurikasviltaan

juurikasveiltansa / juurikasveiltaan

Tra

-ksi

juurikasvikseni

juurikasveikseni

juurikasviksesi

juurikasveiksesi

juurikasviksensa / juurikasvikseen

juurikasveiksensa / juurikasveikseen

Ess

-na

juurikasvinani

juurikasveinani

juurikasvinasi

juurikasveinasi

juurikasvinansa / juurikasvinaan

juurikasveinansa / juurikasveinaan

Abe

-tta

juurikasvittani

juurikasveittani

juurikasvittasi

juurikasveittasi

juurikasvittansa / juurikasvittaan

juurikasveittansa / juurikasveittaan

Com

-ne

-

juurikasveineni

-

juurikasveinesi

-

juurikasveinensa / juurikasveineen

Singular

Plural

Nom

-

juurikasvini

juurikasvisi

juurikasvinsa

juurikasvini

juurikasvisi

juurikasvinsa

Par

-ta

juurikasviani

juurikasviasi

juurikasviansa / juurikasviaan

juurikasvejani

juurikasvejasi

juurikasvejansa / juurikasvejaan

Gen

-n

juurikasvini

juurikasvisi

juurikasvinsa

juurikasvieni

juurikasviesi

juurikasviensa

Ill

mihin

juurikasviini

juurikasviisi

juurikasviinsa

juurikasveihini

juurikasveihisi

juurikasveihinsa

Ine

-ssa

juurikasvissani

juurikasvissasi

juurikasvissansa / juurikasvissaan

juurikasveissani

juurikasveissasi

juurikasveissansa / juurikasveissaan

Ela

-sta

juurikasvistani

juurikasvistasi

juurikasvistansa / juurikasvistaan

juurikasveistani

juurikasveistasi

juurikasveistansa / juurikasveistaan

All

-lle

juurikasvilleni

juurikasvillesi

juurikasvillensa / juurikasvilleen

juurikasveilleni

juurikasveillesi

juurikasveillensa / juurikasveillean

Ade

-lla

juurikasvillani

juurikasvillasi

juurikasvillansa / juurikasvillaan

juurikasveillani

juurikasveillasi

juurikasveillansa / juurikasveillaan

Abl

-lta

juurikasviltani

juurikasviltasi

juurikasviltansa / juurikasviltaan

juurikasveiltani

juurikasveiltasi

juurikasveiltansa / juurikasveiltaan

Tra

-ksi

juurikasvikseni

juurikasviksesi

juurikasviksensa / juurikasvikseen

juurikasveikseni

juurikasveiksesi

juurikasveiksensa / juurikasveikseen

Ess

-na

juurikasvinani

juurikasvinasi

juurikasvinansa / juurikasvinaan

juurikasveinani

juurikasveinasi

juurikasveinansa / juurikasveinaan

Abe

-tta

juurikasvittani

juurikasvittasi

juurikasvittansa / juurikasvittaan

juurikasveittani

juurikasveittasi

juurikasveittansa / juurikasveittaan

Com

-ne

-

-

-

juurikasveineni

juurikasveinesi

juurikasveinensa / juurikasveineen

-mme

-nne

-nsa (plural)

Singular

Plural

Singular

Plural

Singular

Plural

Nom

-

juurikasvimme

juurikasvimme

juurikasvinne

juurikasvinne

juurikasvinsa

juurikasvinsa

Par

-ta

juurikasviamme

juurikasvejamme

juurikasvianne

juurikasvejanne

juurikasviansa / juurikasviaan

juurikasvejansa / juurikasvejaan

Gen

-n

juurikasvimme

juurikasviemme

juurikasvinne

juurikasvienne

juurikasvinsa

juurikasviensa

Ill

mihin

juurikasviimme

juurikasveihimme

juurikasviinne

juurikasveihinne

juurikasviinsa

juurikasveihinsa

Ine

-ssa

juurikasvissamme

juurikasveissamme

juurikasvissanne

juurikasveissanne

juurikasvissansa / juurikasvissaan

juurikasveissansa / juurikasveissaan

Ela

-sta

juurikasvistamme

juurikasveistamme

juurikasvistanne

juurikasveistanne

juurikasvistansa / juurikasvistaan

juurikasveistansa / juurikasveistaan

All

-lle

juurikasvillemme

juurikasveillemme

juurikasvillenne

juurikasveillenne

juurikasvillensa / juurikasvilleen

juurikasveillensa / juurikasveillean

Ade

-lla

juurikasvillamme

juurikasveillamme

juurikasvillanne

juurikasveillanne

juurikasvillansa / juurikasvillaan

juurikasveillansa / juurikasveillaan

Abl

-lta

juurikasviltamme

juurikasveiltamme

juurikasviltanne

juurikasveiltanne

juurikasviltansa / juurikasviltaan

juurikasveiltansa / juurikasveiltaan

Tra

-ksi

juurikasviksemme

juurikasveiksemme

juurikasviksenne

juurikasveiksenne

juurikasviksensa / juurikasvikseen

juurikasveiksensa / juurikasveikseen

Ess

-na

juurikasvinamme

juurikasveinamme

juurikasvinanne

juurikasveinanne

juurikasvinansa / juurikasvinaan

juurikasveinansa / juurikasveinaan

Abe

-tta

juurikasvittamme

juurikasveittamme

juurikasvittanne

juurikasveittanne

juurikasvittansa / juurikasvittaan

juurikasveittansa / juurikasveittaan

Com

-ne

-

juurikasveinemme

-

juurikasveinenne

-

juurikasveinensa / juurikasveineen

Singular

Plural

Nom

-

juurikasvimme

juurikasvinne

juurikasvinsa

juurikasvimme

juurikasvinne

juurikasvinsa

Par

-ta

juurikasviamme

juurikasvianne

juurikasviansa / juurikasviaan

juurikasvejamme

juurikasvejanne

juurikasvejansa / juurikasvejaan

Gen

-n

juurikasvimme

juurikasvinne

juurikasvinsa

juurikasviemme

juurikasvienne

juurikasviensa

Ill

mihin

juurikasviimme

juurikasviinne

juurikasviinsa

juurikasveihimme

juurikasveihinne

juurikasveihinsa

Ine

-ssa

juurikasvissamme

juurikasvissanne

juurikasvissansa / juurikasvissaan

juurikasveissamme

juurikasveissanne

juurikasveissansa / juurikasveissaan

Ela

-sta

juurikasvistamme

juurikasvistanne

juurikasvistansa / juurikasvistaan

juurikasveistamme

juurikasveistanne

juurikasveistansa / juurikasveistaan

All

-lle

juurikasvillemme

juurikasvillenne

juurikasvillensa / juurikasvilleen

juurikasveillemme

juurikasveillenne

juurikasveillensa / juurikasveillean

Ade

-lla

juurikasvillamme

juurikasvillanne

juurikasvillansa / juurikasvillaan

juurikasveillamme

juurikasveillanne

juurikasveillansa / juurikasveillaan

Abl

-lta

juurikasviltamme

juurikasviltanne

juurikasviltansa / juurikasviltaan

juurikasveiltamme

juurikasveiltanne

juurikasveiltansa / juurikasveiltaan

Tra

-ksi

juurikasviksemme

juurikasviksenne

juurikasviksensa / juurikasvikseen

juurikasveiksemme

juurikasveiksenne

juurikasveiksensa / juurikasveikseen

Ess

-na

juurikasvinamme

juurikasvinanne

juurikasvinansa / juurikasvinaan

juurikasveinamme

juurikasveinanne

juurikasveinansa / juurikasveinaan

Abe

-tta

juurikasvittamme

juurikasvittanne

juurikasvittansa / juurikasvittaan

juurikasveittamme

juurikasveittanne

juurikasveittansa / juurikasveittaan

Com

-ne

-

-

-

juurikasveinemme

juurikasveinenne

juurikasveinensa / juurikasveineen

Declensions

Singular

Plural

Nom

-

juuri

juuret

Par

-ta

juurta

juuria

Gen

-n

juuren

juurien / juurten

Ill

mihin

juureen

juuriin

Ine

-ssa

juuressa

juurissa

Ela

-sta

juuresta

juurista

All

-lle

juurelle

juurille

Ade

-lla

juurella

juurilla

Abl

-lta

juurelta

juurilta

Tra

-ksi

juureksi

juuriksi

Ess

-na

juurena

juurina

Abe

-tta

juuretta

juuritta

Com

-ne

-

juurine

Ins

-in

-

juurin

Declensions

Singular

Plural

Nom

-

juuri

juuret

Par

-ta

juurta

juuria

Gen

-n

juuren

juurien / juurten

Ill

mihin

juureen

juuriin

Ine

-ssa

juuressa

juurissa

Ela

-sta

juuresta

juurista

All

-lle

juurelle

juurille

Ade

-lla

juurella

juurilla

Abl

-lta

juurelta

juurilta

Tra

-ksi

juureksi

juuriksi

Ess

-na

juurena

juurina

Abe

-tta

juuretta

juuritta

Com

-ne

-

juurine

Ins

-in

-

juurin

Get Premium! For Unlimited access Log in or Get Premium. You can now close this dialog and continue using Kieli.net in 4s. First 7 days FREE Trial!

Start Free Trial

Close

root juuri, ydin, kanta, alkuperä
just vain, juuri, ainoastaan, yksinkertaisesti, juuri ja juuri, oikein
right oikealle, oikealla, aivan, oikein, juuri, suoraan
exactly täsmälleen, tarkalleen, juuri, aivan
very erittäin, hyvin, kovin, aivan, juuri, oikein
freshly juuri, vasta, äskettäin
only just juuri, juuri ja juuri, vasta äsken, nipin napin
foot jalka, jalkaterä, alaosa, kanta, juuri, alareuna
bottom pohja, alaosa, alapää, peppu, alalaita, juuri
base tukikohta, pohja, perusta, emäs, alusta, juuri
mother äiti, emä, emo, alku, juuri, maammo
of all kaikista, juuri
Show more arrow right
Tatoeba Parallel Corpus; Europarl; Europarl Parallel Corpus; Tatoeba Sentence Corpus; OpenSubtitles2018.v3; OPUS Parallel Corpus; OPUS Corpus Mutta haluan myös juuria. But I also want to root. Juureksemme ei eksynyt kukaan. No one got lost on our way. Juuressanne ongelma piilee. The problem lies at the root of you. Juuressanne oli syvä reikä. There was a deep hole at your feet. Olimme teltassa juuressanne. We were in the tent at your feet. Juureni kasvavat nopeasti täällä. My roots grow quickly here. Hyvä paikka kaivaa juuria. A good place to dig for roots. Rakennamme talon juureen. We are building the house at the root. Lumi suli nopeasti juuressanne. The snow melted quickly at your feet. Laitetaanpa lamppu juureen. Let's put the lamp at the foot. Show more arrow right

Wiktionary

root (of a plant, hair, tooth etc.) Short for taikinajuuri (“starter dough”). (mathematics) root (mathematical analysis) a zero of a function (figuratively) cause, origin, tradition Show more arrow right täsmälleen Show more arrow right jalkojen juuressajuurakkojuurehtiajuurekasjuuresjuuretonjuurevajuuriajuurikas-juurinenjuuristojuurittaajuurruttaajuurtaajuurtua Show more arrow right alkeisjuurialkujuurialvejuuriarrowjuuriginsengjuurihampaanjuurihapanjuuriharajuurihirvenjuurihiusjuuriilmajuurijuurenhaarajuurenottojuuriartisokkajuurieläinjuuriharjajuurihoitaajuurihoitojuurihuntujuurijalkainenjuurikalvojuurikanavajuurikarvajuurikasvijuurikorijuurikääpäjuurilahojuurilausekejuurimatojuurimattojuurimerkkijuurimukulajuurinystyräjuuriosajuuripaakkujuuripaikkajuuripermanenttijuuripuujuurisellerijuuritäytejuuriversojuurivesajuurta jaksaenjuurta jaksainkalmojuurikarvanjuurikeltajuurikuutiojuurikynnenjuurilakritsijuurilisäjuurimukulajuurimustajuurineliöjuurinenänjuurinuolijuuriperin juurinpesäjuuripiparjuuripukinjuuripunajuuripurtojuuripuunjuuripärskäjuuripääjuuriruohonjuuritasorusojuuriruttojuurisienijuurisirkkajuurisukujuurisydänjuuretsyyläjuuritaikinanjuuriverijuuriversojuurivirmajuuri Show more arrow right From Proto-Finnic juuri, from Proto-Finno-Permic jure. Show more arrow right

Wikipedia

Root In vascular plants, the roots are the organs of a plant that are modified to provide anchorage for the plant and take in water and nutrients into the plant body, which allows plants to grow taller and faster. They most often lie below the surface of the soil, but roots can also be aerial or aerating, that is, growing up above the ground or especially above water. Show more arrow right

-ni

-si

-nsa (singular)

Singular

Plural

Singular

Plural

Singular

Plural

Nom

-

juureni

juureni

juuresi

juuresi

juurensa

juurensa

Par

-ta

juurtani

juuriani

juurtasi

juuriasi

juurtansa / juurtaan

juuriansa / juuriaan

Gen

-n

juureni

juurieni / juurteni

juuresi

juuriesi / juurtesi

juurensa

juuriensa / juurtensa

Ill

mihin

juureeni

juuriini

juureesi

juuriisi

juureensa

juuriinsa

Ine

-ssa

juuressani

juurissani

juuressasi

juurissasi

juuressansa / juuressaan

juurissansa / juurissaan

Ela

-sta

juurestani

juuristani

juurestasi

juuristasi

juurestansa / juurestaan

juuristansa / juuristaan

All

-lle

juurelleni

juurilleni

juurellesi

juurillesi

juurellensa / juurelleen

juurillensa / juurillean

Ade

-lla

juurellani

juurillani

juurellasi

juurillasi

juurellansa / juurellaan

juurillansa / juurillaan

Abl

-lta

juureltani

juuriltani

juureltasi

juuriltasi

juureltansa / juureltaan

juuriltansa / juuriltaan

Tra

-ksi

juurekseni

juurikseni

juureksesi

juuriksesi

juureksensa / juurekseen

juuriksensa / juurikseen

Ess

-na

juurenani

juurinani

juurenasi

juurinasi

juurenansa / juurenaan

juurinansa / juurinaan

Abe

-tta

juurettani

juurittani

juurettasi

juurittasi

juurettansa / juurettaan

juurittansa / juurittaan

Com

-ne

-

juurineni

-

juurinesi

-

juurinensa / juurineen

Singular

Plural

Nom

-

juureni

juuresi

juurensa

juureni

juuresi

juurensa

Par

-ta

juurtani

juurtasi

juurtansa / juurtaan

juuriani

juuriasi

juuriansa / juuriaan

Gen

-n

juureni

juuresi

juurensa

juurieni / juurteni

juuriesi / juurtesi

juuriensa / juurtensa

Ill

mihin

juureeni

juureesi

juureensa

juuriini

juuriisi

juuriinsa

Ine

-ssa

juuressani

juuressasi

juuressansa / juuressaan

juurissani

juurissasi

juurissansa / juurissaan

Ela

-sta

juurestani

juurestasi

juurestansa / juurestaan

juuristani

juuristasi

juuristansa / juuristaan

All

-lle

juurelleni

juurellesi

juurellensa / juurelleen

juurilleni

juurillesi

juurillensa / juurillean

Ade

-lla

juurellani

juurellasi

juurellansa / juurellaan

juurillani

juurillasi

juurillansa / juurillaan

Abl

-lta

juureltani

juureltasi

juureltansa / juureltaan

juuriltani

juuriltasi

juuriltansa / juuriltaan

Tra

-ksi

juurekseni

juureksesi

juureksensa / juurekseen

juurikseni

juuriksesi

juuriksensa / juurikseen

Ess

-na

juurenani

juurenasi

juurenansa / juurenaan

juurinani

juurinasi

juurinansa / juurinaan

Abe

-tta

juurettani

juurettasi

juurettansa / juurettaan

juurittani

juurittasi

juurittansa / juurittaan

Com

-ne

-

-

-

juurineni

juurinesi

juurinensa / juurineen

-mme

-nne

-nsa (plural)

Singular

Plural

Singular

Plural

Singular

Plural

Nom

-

juuremme

juuremme

juurenne

juurenne

juurensa

juurensa

Par

-ta

juurtamme

juuriamme

juurtanne

juurianne

juurtansa / juurtaan

juuriansa / juuriaan

Gen

-n

juuremme

juuriemme / juurtemme

juurenne

juurienne / juurtenne

juurensa

juuriensa / juurtensa

Ill

mihin

juureemme

juuriimme

juureenne

juuriinne

juureensa

juuriinsa

Ine

-ssa

juuressamme

juurissamme

juuressanne

juurissanne

juuressansa / juuressaan

juurissansa / juurissaan

Ela

-sta

juurestamme

juuristamme

juurestanne

juuristanne

juurestansa / juurestaan

juuristansa / juuristaan

All

-lle

juurellemme

juurillemme

juurellenne

juurillenne

juurellensa / juurelleen

juurillensa / juurillean

Ade

-lla

juurellamme

juurillamme

juurellanne

juurillanne

juurellansa / juurellaan

juurillansa / juurillaan

Abl

-lta

juureltamme

juuriltamme

juureltanne

juuriltanne

juureltansa / juureltaan

juuriltansa / juuriltaan

Tra

-ksi

juureksemme

juuriksemme

juureksenne

juuriksenne

juureksensa / juurekseen

juuriksensa / juurikseen

Ess

-na

juurenamme

juurinamme

juurenanne

juurinanne

juurenansa / juurenaan

juurinansa / juurinaan

Abe

-tta

juurettamme

juurittamme

juurettanne

juurittanne

juurettansa / juurettaan

juurittansa / juurittaan

Com

-ne

-

juurinemme

-

juurinenne

-

juurinensa / juurineen

Singular

Plural

Nom

-

juuremme

juurenne

juurensa

juuremme

juurenne

juurensa

Par

-ta

juurtamme

juurtanne

juurtansa / juurtaan

juuriamme

juurianne

juuriansa / juuriaan

Gen

-n

juuremme

juurenne

juurensa

juuriemme / juurtemme

juurienne / juurtenne

juuriensa / juurtensa

Ill

mihin

juureemme

juureenne

juureensa

juuriimme

juuriinne

juuriinsa

Ine

-ssa

juuressamme

juuressanne

juuressansa / juuressaan

juurissamme

juurissanne

juurissansa / juurissaan

Ela

-sta

juurestamme

juurestanne

juurestansa / juurestaan

juuristamme

juuristanne

juuristansa / juuristaan

All

-lle

juurellemme

juurellenne

juurellensa / juurelleen

juurillemme

juurillenne

juurillensa / juurillean

Ade

-lla

juurellamme

juurellanne

juurellansa / juurellaan

juurillamme

juurillanne

juurillansa / juurillaan

Abl

-lta

juureltamme

juureltanne

juureltansa / juureltaan

juuriltamme

juuriltanne

juuriltansa / juuriltaan

Tra

-ksi

juureksemme

juureksenne

juureksensa / juurekseen

juuriksemme

juuriksenne

juuriksensa / juurikseen

Ess

-na

juurenamme

juurenanne

juurenansa / juurenaan

juurinamme

juurinanne

juurinansa / juurinaan

Abe

-tta

juurettamme

juurettanne

juurettansa / juurettaan

juurittamme

juurittanne

juurittansa / juurittaan

Com

-ne

-

-

-

juurinemme

juurinenne

juurinensa / juurineen

Declensions

Singular

Plural

Nom

-

kasvi

kasvit

Par

-ta

kasvia

kasveja

Gen

-n

kasvin

kasvien

Ill

mihin

kasviin

kasveihin

Ine

-ssa

kasvissa

kasveissa

Ela

-sta

kasvista

kasveista

All

-lle

kasville

kasveille

Ade

-lla

kasvilla

kasveilla

Abl

-lta

kasvilta

kasveilta

Tra

-ksi

kasviksi

kasveiksi

Ess

-na

kasvina

kasveina

Abe

-tta

kasvitta

kasveitta

Com

-ne

-

kasveine

Ins

-in

-

kasvein

Declensions

Singular

Plural

Nom

-

kasvi

kasvit

Par

-ta

kasvia

kasveja

Gen

-n

kasvin

kasvien

Ill

mihin

kasviin

kasveihin

Ine

-ssa

kasvissa

kasveissa

Ela

-sta

kasvista

kasveista

All

-lle

kasville

kasveille

Ade

-lla

kasvilla

kasveilla

Abl

-lta

kasvilta

kasveilta

Tra

-ksi

kasviksi

kasveiksi

Ess

-na

kasvina

kasveina

Abe

-tta

kasvitta

kasveitta

Com

-ne

-

kasveine

Ins

-in

-

kasvein

Get Premium! For Unlimited access Log in or Get Premium. You can now close this dialog and continue using Kieli.net in 4s. First 7 days FREE Trial!

Start Free Trial

Close

plant kasvi, tehdas, laitteet, voimala, koneet, taimi
vegetable kasvis, vihannes, kasvi, tylsimys
veg vihannes, kasvis, kasvi, tylsimys
veggie kasvis, kasvissyöjä, vihannes, vegetaari, kasvi, tylsimys
Show more arrow right
OpenSubtitles2018.v3; Tatoeba Parallel Corpus, sentence 123456.; jw2019; Europarl; tmClass; Europarl Parallel Corpus, sentence ID: 1000 Se on kasvi. It's a plant. Kasvinsyöjä ei syö lihaa. A vegetarian doesn't eat meat. Tässä olisi kasvihuoneeni. This would be my greenhouse. Kasvimaan suuruus. Size of Your Garden. Kasvi tarvitsee vettä ja valoa kasvaakseen. The plant needs water and light to grow. Puhdasta kasviöljyä. Pure vegetable. Kasvihuoneet lasista. Greenhouses of glass. Kasvimaassa on arvoja. Garden is value. Kasvinsyöjä dinosauruksia. Plant-eating dinosaurs. Kasvituholainen on tuhonnut sadon. The plant pest has destroyed the crop. Show more arrow right

Wiktionary

plant Show more arrow right kasvillisuuskasviokasviskasvistokasvittaakasvittua Show more arrow right akvaariokasvialuskasviamppelikasviananaskasviarokasviemikasviemokasviemäkkikasviesikasvihedekasvihedelmäkasviheinäkasvihernekasvihorsmakasvihuonekasvihuulikukkaiskasvihuumekasvihyötykasviinkiväärikasviisäntäkasviitiökasvijalavakasvijuurikasvijälkikasvijääruohokasvikallioimarrekasvikalliokasvikanervakasvikasvianatomiakasvibiologiakasviekologiakasviestrogeenikasvifossiilikasvifysiologiakasviheimokasvihormonikasvihuonekasvihuoneilmiökasvihuonekaasukasvihuonekurkkukasvihuoneviljelykasvijätekasvikarttakasvikokoelmakasvikuitukasvikuivainkasvikuntakasvilajikasvilajikekasvilajistokasvilamppukasvilavakasviliimakasvilääkintäkasvimaakasvimaailmakasvimaantiedekasvimargariinikasvimuseokasvimyrkkykasvinestekasvinjalostuskasvinjätekasvinlehtikasvinosakasvinravinnekasvinsuojelukasvinsuojeluainekasvinsyöjäkasvintarkastuskasvintuotantokasvinviljelijäkasvinviljelykasvinvuorottelukasvinvuorotuskasvinäytekasviopillinenkasvioppikasviornamenttikasvipatologiakasvipeitekasvipenkkikasvipigmenttikasviplanktonkasvipuristinkasvirasvakasvirasvajäätelökasviravinnekasviravintokasvisterolikasvisyöntikasvitarhakasvitarhanhoitajakasvitautikasvitautioppikasvitiedekasvitieteellinenkasvitieteilijäkasvituholainenkasvituotekasvityyppikasviuutekasvivalaisinkasvivalkuainenkasvivuorottelukasvivärikasvivärjäyskasviyhdyskuntakasviöljykautsukasvikeittiökasvikellokasvikiertokasvikiipijäkasvikivikkokasvikohokkikasvikoisokasvikompassikasvikoristekasvikosteikkokasvikuitukasvikuivakkokasvikukkakasvikumikasvikurkkukasvikämmekkäkasviköynnöskasvilaakerikasvilakritsikasvilehmuskasvilehtokasvileinikkikasvilemmikkikasviliekokasvilihansyöjäkasvililjakasvilimaskakasviloiskasvilummekasviluonnonkasvilääkekasvimaakuntakasvimahonkikasvimalvakasvimangrovepuukasvimarjakasvimarraskasvimaustekasvimehikasvimerenrantakasvimerikasvimetsäkasvimonivuotinen kasvimukulakasvimulperikasvimyrkkykasvinarsissikasviniittykasvinokkoskasvinorkkokasvinuottaruohokasvinurmikasvinurmikkokasvipajukasvipalkokasviparvekekasvipatjakasvipensaskasvipippurikasviputkilokasvipuutarhakasvipäällyskasvirahakasvirantakasviraunioiskasviravintokasvirehukasvireunuskasvirikkakasvirisiinikasviristikukkaiskasvirohdoskasviruohokasviruokokasviruukkukasviruusukasviryhmäkasvisalaattikasvisammalkasvisaniaiskasvisarjakukkaiskasvisavikkakasvisiemenkasvisipulikasvisokerikasvisuojakasvisuokasvisuolakkokasvisypressikasvitatarkasviteollisuuskasvitundrakasvitunnuskasvituntokasvituntopuukasvitunturikasvitärkkelyskasviuposkasvivehkakasviversokasvivesikasvivihanneskasviviherkasviviljakasviviljelykasviviljelyskasvivitakasvivuoristokasvivärikasviöljykasvi Show more arrow right kasv- +‎ -i. Modern meaning given by Finnish physician and author Samuel Roos. Show more arrow right

Wikipedia

Plant Plants are mainly multicellular organisms, predominantly photosynthetic eukaryotes of the kingdom Plantae. Historically, plants were treated as one of two kingdoms including all living things that were not animals, and all algae and fungi were treated as plants. However, all current definitions of Plantae exclude the fungi and some algae, as well as the prokaryotes (the archaea and bacteria). Show more arrow right

-ni

-si

-nsa (singular)

Singular

Plural

Singular

Plural

Singular

Plural

Nom

-

kasvini

kasvini

kasvisi

kasvisi

kasvinsa

kasvinsa

Par

-ta

kasviani

kasvejani

kasviasi

kasvejasi

kasviansa / kasviaan

kasvejansa / kasvejaan

Gen

-n

kasvini

kasvieni

kasvisi

kasviesi

kasvinsa

kasviensa

Ill

mihin

kasviini

kasveihini

kasviisi

kasveihisi

kasviinsa

kasveihinsa

Ine

-ssa

kasvissani

kasveissani

kasvissasi

kasveissasi

kasvissansa / kasvissaan

kasveissansa / kasveissaan

Ela

-sta

kasvistani

kasveistani

kasvistasi

kasveistasi

kasvistansa / kasvistaan

kasveistansa / kasveistaan

All

-lle

kasvilleni

kasveilleni

kasvillesi

kasveillesi

kasvillensa / kasvilleen

kasveillensa / kasveillean

Ade

-lla

kasvillani

kasveillani

kasvillasi

kasveillasi

kasvillansa / kasvillaan

kasveillansa / kasveillaan

Abl

-lta

kasviltani

kasveiltani

kasviltasi

kasveiltasi

kasviltansa / kasviltaan

kasveiltansa / kasveiltaan

Tra

-ksi

kasvikseni

kasveikseni

kasviksesi

kasveiksesi

kasviksensa / kasvikseen

kasveiksensa / kasveikseen

Ess

-na

kasvinani

kasveinani

kasvinasi

kasveinasi

kasvinansa / kasvinaan

kasveinansa / kasveinaan

Abe

-tta

kasvittani

kasveittani

kasvittasi

kasveittasi

kasvittansa / kasvittaan

kasveittansa / kasveittaan

Com

-ne

-

kasveineni

-

kasveinesi

-

kasveinensa / kasveineen

Singular

Plural

Nom

-

kasvini

kasvisi

kasvinsa

kasvini

kasvisi

kasvinsa

Par

-ta

kasviani

kasviasi

kasviansa / kasviaan

kasvejani

kasvejasi

kasvejansa / kasvejaan

Gen

-n

kasvini

kasvisi

kasvinsa

kasvieni

kasviesi

kasviensa

Ill

mihin

kasviini

kasviisi

kasviinsa

kasveihini

kasveihisi

kasveihinsa

Ine

-ssa

kasvissani

kasvissasi

kasvissansa / kasvissaan

kasveissani

kasveissasi

kasveissansa / kasveissaan

Ela

-sta

kasvistani

kasvistasi

kasvistansa / kasvistaan

kasveistani

kasveistasi

kasveistansa / kasveistaan

All

-lle

kasvilleni

kasvillesi

kasvillensa / kasvilleen

kasveilleni

kasveillesi

kasveillensa / kasveillean

Ade

-lla

kasvillani

kasvillasi

kasvillansa / kasvillaan

kasveillani

kasveillasi

kasveillansa / kasveillaan

Abl

-lta

kasviltani

kasviltasi

kasviltansa / kasviltaan

kasveiltani

kasveiltasi

kasveiltansa / kasveiltaan

Tra

-ksi

kasvikseni

kasviksesi

kasviksensa / kasvikseen

kasveikseni

kasveiksesi

kasveiksensa / kasveikseen

Ess

-na

kasvinani

kasvinasi

kasvinansa / kasvinaan

kasveinani

kasveinasi

kasveinansa / kasveinaan

Abe

-tta

kasvittani

kasvittasi

kasvittansa / kasvittaan

kasveittani

kasveittasi

kasveittansa / kasveittaan

Com

-ne

-

-

-

kasveineni

kasveinesi

kasveinensa / kasveineen

-mme

-nne

-nsa (plural)

Singular

Plural

Singular

Plural

Singular

Plural

Nom

-

kasvimme

kasvimme

kasvinne

kasvinne

kasvinsa

kasvinsa

Par

-ta

kasviamme

kasvejamme

kasvianne

kasvejanne

kasviansa / kasviaan

kasvejansa / kasvejaan

Gen

-n

kasvimme

kasviemme

kasvinne

kasvienne

kasvinsa

kasviensa

Ill

mihin

kasviimme

kasveihimme

kasviinne

kasveihinne

kasviinsa

kasveihinsa

Ine

-ssa

kasvissamme

kasveissamme

kasvissanne

kasveissanne

kasvissansa / kasvissaan

kasveissansa / kasveissaan

Ela

-sta

kasvistamme

kasveistamme

kasvistanne

kasveistanne

kasvistansa / kasvistaan

kasveistansa / kasveistaan

All

-lle

kasvillemme

kasveillemme

kasvillenne

kasveillenne

kasvillensa / kasvilleen

kasveillensa / kasveillean

Ade

-lla

kasvillamme

kasveillamme

kasvillanne

kasveillanne

kasvillansa / kasvillaan

kasveillansa / kasveillaan

Abl

-lta

kasviltamme

kasveiltamme

kasviltanne

kasveiltanne

kasviltansa / kasviltaan

kasveiltansa / kasveiltaan

Tra

-ksi

kasviksemme

kasveiksemme

kasviksenne

kasveiksenne

kasviksensa / kasvikseen

kasveiksensa / kasveikseen

Ess

-na

kasvinamme

kasveinamme

kasvinanne

kasveinanne

kasvinansa / kasvinaan

kasveinansa / kasveinaan

Abe

-tta

kasvittamme

kasveittamme

kasvittanne

kasveittanne

kasvittansa / kasvittaan

kasveittansa / kasveittaan

Com

-ne

-

kasveinemme

-

kasveinenne

-

kasveinensa / kasveineen

Singular

Plural

Nom

-

kasvimme

kasvinne

kasvinsa

kasvimme

kasvinne

kasvinsa

Par

-ta

kasviamme

kasvianne

kasviansa / kasviaan

kasvejamme

kasvejanne

kasvejansa / kasvejaan

Gen

-n

kasvimme

kasvinne

kasvinsa

kasviemme

kasvienne

kasviensa

Ill

mihin

kasviimme

kasviinne

kasviinsa

kasveihimme

kasveihinne

kasveihinsa

Ine

-ssa

kasvissamme

kasvissanne

kasvissansa / kasvissaan

kasveissamme

kasveissanne

kasveissansa / kasveissaan

Ela

-sta

kasvistamme

kasvistanne

kasvistansa / kasvistaan

kasveistamme

kasveistanne

kasveistansa / kasveistaan

All

-lle

kasvillemme

kasvillenne

kasvillensa / kasvilleen

kasveillemme

kasveillenne

kasveillensa / kasveillean

Ade

-lla

kasvillamme

kasvillanne

kasvillansa / kasvillaan

kasveillamme

kasveillanne

kasveillansa / kasveillaan

Abl

-lta

kasviltamme

kasviltanne

kasviltansa / kasviltaan

kasveiltamme

kasveiltanne

kasveiltansa / kasveiltaan

Tra

-ksi

kasviksemme

kasviksenne

kasviksensa / kasvikseen

kasveiksemme

kasveiksenne

kasveiksensa / kasveikseen

Ess

-na

kasvinamme

kasvinanne

kasvinansa / kasvinaan

kasveinamme

kasveinanne

kasveinansa / kasveinaan

Abe

-tta

kasvittamme

kasvittanne

kasvittansa / kasvittaan

kasveittamme

kasveittanne

kasveittansa / kasveittaan

Com

-ne

-

-

-

kasveinemme

kasveinenne

kasveinensa / kasveineen

Get Premium! For Unlimited access Log in or Get Premium. You can now close this dialog and continue using Kieli.net in 4s. First 7 days FREE Trial!

Start Free Trial

Close

Create new exercises Report an issue Exercises Solved!
close modal
Source:
Report an issue
close modal
If you wish to receive updates on this issue:
SuccessIssue reported! Report
logo
  • Social Instagram
  • Social Facebook

Contact

envelope contact@kieli.net

Copyright 2019-2024, kieli.net

We value your privacy
Kieli.net uses cookies to enhance the browsing experience, serve personalized content, and analyze traffic. To learn more, please refer to the Cookie policy. By clicking "Accept" you consent to Kieli.net's use of cookies. Accept